DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxb1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001107970.1 Gene:foxb1 / 100125219 XenbaseID:XB-GENE-1018255 Length:322 Species:Xenopus tropicalis


Alignment Length:98 Identity:65/98 - (66%)
Similarity:73/98 - (74%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            |||||||:|..|||..|..|.|.||.|..|||.|||||::....||||:|||||.||||||:||.
 Frog    13 KPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182
            |..||||:||.|.|...|||:||||||||||:|
 Frog    78 PDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 54/85 (64%)
foxb1NP_001107970.1 FH 13..101 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.