DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxd7

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:156 Identity:98/156 - (62%)
Similarity:111/156 - (71%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DDSDIEPSSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSR 118
            |:.:..|||:          ..|.||....|||||||||||||||||||.|:||||.|||||..|
Zfish    43 DEENHVPSSI----------CPSSSSKSSSVKPPYSYIALITMAILQSPKKRLTLSEICDFISHR 97

  Fly   119 FPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR 183
            |.||::|||||||||||||||||||:|:|||||||||||:|||||.:.|||:||||||||||:||
Zfish    98 FVYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGSFLRRRKRFKR 162

  Fly   184 APTMQRFSF---------PAVFGTLS 200
                |.|.|         |:.|..||
Zfish   163 ----QHFKFGVFKDQALQPSGFPNLS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 71/85 (84%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 68/82 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.