DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNJ6 and Irk3

DIOPT Version :9

Sequence 1:NP_002231.1 Gene:KCNJ6 / 3763 HGNCID:6267 Length:423 Species:Homo sapiens
Sequence 2:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster


Alignment Length:368 Identity:114/368 - (30%)
Similarity:198/368 - (53%) Gaps:39/368 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    41 PRHISRDRTKRKIQRYVRKDGKCNVHHGNVRE-TYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTW 104
            ||..|.|..:|.:.|.:.|:||.||....:.| ::||:.|:.|||::|:|::.|.:|:..|.::|
  Fly   103 PRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSW 167

Human   105 LFFGMIWWLIAYIRGDMDHIEDP--------SWTPCVTNLNGFVSAFLFSIETETTIGYGYRVIT 161
            |.|..:.:::||..||.  |.||        ...||:..::.:|:..::|:||:||:|:|.:..:
  Fly   168 LLFAALCYVVAYSHGDF--IFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYAS 230

Human   162 DKCPEGIILLLIQSVLGSIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGD 226
            ::|||.|.|.::|.:..:::...||..::.|.::|.::...|.||..|||..|||:|||:|||.|
  Fly   231 EECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCD 295

Human   227 LRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWE 291
            .|....:|:.||..:|..|:|.|||.|. :..::.:   .|:....::.|.::.|.|::.||..:
  Fly   296 PREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSPLSQ 356

Human   292 ISKAQL-PKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVL--TLEDGFYEVDYNS 353
            .:.|:| ...:.|:.|.:.|...||....:|::||:..||.||.||..::  ..::..|.|||.:
  Fly   357 FTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYEN 421

Human   354 FHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELE 396
            |:.|.....|..:.|                     |.|.:||
  Fly   422 FNRTISVDMPMTNPK---------------------NDHLKLE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNJ6NP_002231.1 IRK 57..196 CDD:395797 46/147 (31%)
Selectivity filter. /evidence=ECO:0000250 152..157 2/4 (50%)
IRK_C 203..375 CDD:407551 57/174 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..423 4/7 (57%)
PDZ-binding 420..423
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 102/318 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.