| Sequence 1: | NP_001246470.1 | Gene: | inaD / 37629 | FlyBaseID: | FBgn0001263 | Length: | 686 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_004279.3 | Gene: | CYTIP / 9595 | HGNCID: | 9506 | Length: | 359 | Species: | Homo sapiens |
| Alignment Length: | 240 | Identity: | 52/240 - (21%) |
|---|---|---|---|
| Similarity: | 87/240 - (36%) | Gaps: | 48/240 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 MVTLDKTGKKSFGICI--VRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDV 91
Fly 92 RNSTEQAVIDLIKEADFKIELEIQTFD-----KSDEQQAKSDPRSNGYMQAKNKFNQEQTTNNNA 151
Fly 152 SGGQG----------------MGQGQGQGQGMAGMNRQQSMQKRNTTFTA--------------- 185
Fly 186 -SMRQKHSNYADEDDE-----DTRDMTGRIRTEAGYEIDRASAGN 224 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| inaD | NP_001246470.1 | PDZ_signaling | 27..115 | CDD:238492 | 26/87 (30%) |
| PDZ_signaling | 259..340 | CDD:238492 | |||
| PDZ_signaling | 377..457 | CDD:238492 | |||
| PDZ_signaling | 500..584 | CDD:238492 | |||
| PDZ_signaling | 597..672 | CDD:238492 | |||
| CYTIP | NP_004279.3 | PDZ_signaling | 76..161 | CDD:238492 | 26/87 (30%) |
| Interaction with CYTH1 | 166..188 | 4/21 (19%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||