DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Gopc

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001186201.1 Gene:Gopc / 94221 MGIID:2149946 Length:463 Species:Mus musculus


Alignment Length:171 Identity:45/171 - (26%)
Similarity:69/171 - (40%) Gaps:28/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDV 91
            |..|.|.|...:..||.|..|:....|      |.|..|.|..||..||.|.|||.||::||.::
Mouse   287 IRKVLLLKEDHEGLGISITGGKEHGVP------ILISEIHPGQPADRCGGLHVGDAILAVNGVNL 345

  Fly    92 RNSTEQAVIDLIKEADFKIELEI----QTFDKSDEQQAKSDPRSNGYMQAKNKFNQEQTTNNNAS 152
            |::..:..:.::.:...:||.|:    ...|..||.....|...:.|....::.  |.:.|:.||
Mouse   346 RDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDEL--EGSGNSGAS 408

  Fly   153 GGQGMGQGQGQGQGMAGMNRQQSMQKRNTTFTASMRQKHSN 193
            .....|:          |...|...|:      ::|..|.|
Mouse   409 CKDSSGE----------MKMLQGYNKK------AVRDAHEN 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 29/91 (32%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
GopcNP_001186201.1 PDZ_signaling 287..369 CDD:238492 29/87 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.