DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and LNX1

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001119800.1 Gene:LNX1 / 84708 HGNCID:6657 Length:728 Species:Homo sapiens


Alignment Length:497 Identity:112/497 - (22%)
Similarity:187/497 - (37%) Gaps:95/497 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FPELIHM-----VTLDKTGK----KSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLK 78
            ||.|.|:     :|..|..:    :|..|.:|.|.     .|....|.|:.|..|......|||.
Human   260 FPRLYHLIPDGEITSIKINRVDPSESLSIRLVGGS-----ETPLVHIIIQHIYRDGVIARDGRLL 319

  Fly    79 VGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEI---QTFDKSDEQQAKS--DPRSNGYMQAK 138
            .||.||.:||.|:.|......:.|:::....:.|.:   |.|...:..||..  .||.:.:....
Human   320 PGDIILKVNGMDISNVPHNYAVRLLRQPCQVLWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVIL 384

  Fly   139 NKFNQEQTTN---------------NNASGGQGMGQGQ-GQGQGMAGMN----RQQSMQKRNTTF 183
            ||.:.|:...               |...||.....|| .:...:..:|    |..|.:......
Human   385 NKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRHGQLEENDRVLAINGHDLRYGSPESAAHLI 449

  Fly   184 TASMRQKHSNYADEDDEDTRDMTGRIRTEAGYEIDRASAGNCKLNKQEKDRDKEQEDEFGYTMAK 248
            .||.|:.|...:    ...|..:..|..|||:.    |.|:......|                 
Human   450 QASERRVHLVVS----RQVRQRSPDIFQEAGWN----SNGSWSPGPGE----------------- 489

  Fly   249 INKRYNMMKDL--------RRIEVQRDASKPLGLALAGHKDRQK--MACFVAGVDPNGALGSVD- 302
               |.|..|.|        :.:.:|:|..:.||:.:||....::  :..:|..|:|.|.: |.| 
Human   490 ---RSNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVI-SRDG 550

  Fly   303 -IKPGDEIVEVNGNVLKNRCHLNASAVFKNVDGDKLVMITSRRKPNDEGMCVKPI-------KKF 359
             ||.||.::.|:|..|.......|.|:.|......::.....::...:..|..|.       ...
Human   551 RIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEPQEDCSSPAALDSNHNMAP 615

  Fly   360 PTASDETKFIFDQFPK----ARTVQVRKE--GFLGIMVIYGKHAEVGS-GIFISDLREGSNAELA 417
            |:....:..::.:.|:    .:.:.:|:.  |.||..::.|.....|: ..||..:.||:.|...
Human   616 PSDWSPSWVMWLELPRCLYNCKDIVLRRNTAGSLGFCIVGGYEEYNGNKPFFIKSIVEGTPAYND 680

  Fly   418 G-VKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLT 458
            | ::.||:|||||...|....:.....|||..:|.:|:.:::
Human   681 GRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITLTIVS 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 25/99 (25%)
PDZ_signaling 259..340 CDD:238492 23/92 (25%)
PDZ_signaling 377..457 CDD:238492 25/83 (30%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
LNX1NP_001119800.1 mRING-HC-C3HC3D_LNX1 38..79 CDD:319693
modified RING-HC finger (C3HC3D-type) 41..78 CDD:319693
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
NPXY motif 181..184
Interaction with MAGEB18. /evidence=ECO:0000269|PubMed:20864041 186..244
PDZ_signaling 272..355 CDD:238492 24/87 (28%)
PDZ_signaling 380..460 CDD:238492 15/79 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..494 7/42 (17%)
PDZ_signaling 505..588 CDD:238492 22/83 (27%)
PDZ_signaling 637..721 CDD:238492 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5448
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19964
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.