DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and PDZD3

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_011541302.1 Gene:PDZD3 / 79849 HGNCID:19891 Length:571 Species:Homo sapiens


Alignment Length:424 Identity:82/424 - (19%)
Similarity:144/424 - (33%) Gaps:139/424 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 PIKKFPTASDETKFIFDQFPKA----RTVQVRKEGFLGIMVI----------------------- 392
            |:...||....|:   .:.|..    |..|...|..||:..:                       
Human    56 PLPTNPTTQHPTR---QKLPSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCL 117

  Fly   393 --------YGKH--AEVG-SGIFISDLREGSNAELAGVKVGDMLLAVNQDVTLESNYDDATGLLK 446
                    :|.|  .|:| :|..:..:..|::|:..|::.||.:||||.||.   .::|...:::
Human   118 LSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDVV---EHEDYAVVVR 179

  Fly   447 RAEGVVTMILLTLKSEEAIKAEKAAEEKKKEEAKKEEEKPQEPATAEIKPNKKILIELKVEKKPM 511
            |.......:|||:.:..|                      .:.|.|::..:..:...|....:|.
Human   180 RIRASSPRVLLTVLARHA----------------------HDVARAQLGEDAHLCPTLGPGVRPR 222

  Fly   512 GVIVCGGKNNHVTTGCVITH--------VYPEGQVAADKRLKIFDHICDINGTPIHVGSMTTLKV 568
               :|....:....|..:||        |...|..|....:.....:.::||.     |:.....
Human   223 ---LCHIVKDEGGFGFSVTHGNQGPFWLVLSTGGAAERAGVPPGARLLEVNGV-----SVEKFTH 279

  Fly   569 HQLFHTTYEKAVTLTVFRADPPELEKFNVDLMKKAGKELGLSLS--------------------- 612
            :||....::....:|:..|. ||:|        :..::|||.|:                     
Human   280 NQLTRKLWQSGQQVTLLVAG-PEVE--------EQCRQLGLPLAAPLAEGWALPTKPRCLHLEKG 335

  Fly   613 PNEIGCTI-----ADLIQGQY-----PEIDSK---LQRGDIITKFNGDALEGLPFQVCYALFKGA 664
            |...|..:     .|...||:     |.:.:|   :|.||.:....|:::|||..:...:..:|.
Human   336 PQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQ 400

  Fly   665 NGKVSMEVTRPK-----------PTL---RTEAP 684
            ...||:.|..|:           |.|   .||||
Human   401 GSCVSLTVVDPEADRFFSMVRLSPLLFLENTEAP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492 23/113 (20%)
PDZ_signaling 500..584 CDD:238492 14/91 (15%)
PDZ_signaling 597..672 CDD:238492 21/108 (19%)
PDZD3XP_011541302.1 PDZ_signaling 113..193 CDD:238492 21/82 (26%)
PDZ_signaling 221..298 CDD:238492 14/84 (17%)
PDZ 326..411 CDD:214570 18/84 (21%)
PDZ_signaling 466..545 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.