DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and grid2ipb

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_009304908.1 Gene:grid2ipb / 559717 ZFINID:ZDB-GENE-040724-161 Length:1383 Species:Danio rerio


Alignment Length:102 Identity:36/102 - (35%)
Similarity:55/102 - (53%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVI 100
            ||||||..: ||...         ::|..::|.|||..|| ||.|||||.|||.|:||.:.:.|:
Zfish   342 GKKSFGFTL-RGHAP---------VWIDSVMPGSPAEACG-LKTGDRILFLNGLDMRNCSHEKVV 395

  Fly   101 DLIKEADFKIELEIQ----TFDKSDE--QQAKSDPRS 131
            .:::.:.....|.::    .:.:||.  ::..|.|||
Zfish   396 SMLQGSGAMPSLVVEEGPVDYPQSDSEPEETPSAPRS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 30/78 (38%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
grid2ipbXP_009304908.1 PDZ_signaling 9..69 CDD:238492
PDZ_signaling 80..156 CDD:238492
HN_L-delphilin-R1_like 183..262 CDD:259820
PDZ_signaling 335..410 CDD:238492 30/78 (38%)
HN_L-delphilin-R2_like 451..530 CDD:259821
FH2 995..1360 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.