DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and PDZD11

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_016885057.1 Gene:PDZD11 / 51248 HGNCID:28034 Length:172 Species:Homo sapiens


Alignment Length:95 Identity:27/95 - (28%)
Similarity:48/95 - (50%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNS 94
            :||.|......|..|..|:...      .||||..::|||.||..| |:.||::|::|..|.::.
Human    80 ITLKKPPGAQLGFNIRGGKASQ------LGIFISKVIPDSDAHRAG-LQEGDQVLAVNDVDFQDI 137

  Fly    95 TEQAVIDLIKEADFKIELEIQTFDKSDEQQ 124
            .....::::|.|. :|.:.::.|..:..:|
Human   138 EHSKAVEILKTAR-EISMRVRFFPYNYHRQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 25/84 (30%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
PDZD11XP_016885057.1 PDZ_signaling 77..157 CDD:238492 25/84 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.