DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and CG6688

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:79 Identity:27/79 - (34%)
Similarity:33/79 - (41%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LRRIEVQRDASKPLGLALAGHK-DRQKMACFVAGVDPNGALGSVDIKPGDEIVEVNGNVLKNRCH 322
            |.||.....|.:..|..|...| |.....|.||...|....|   :||||.::|||||.:..   
  Fly    26 LLRIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCG---LKPGDCVLEVNGNDVLG--- 84

  Fly   323 LNASAVFKNVDGDK 336
            |..|.:.|.|...|
  Fly    85 LRVSEIAKMVKSQK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 27/79 (34%)
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 27/79 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.