DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and CG34375

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:170 Identity:34/170 - (20%)
Similarity:59/170 - (34%) Gaps:66/170 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GTAGVFISFGMHNPFPELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHL 73
            ||.|:.:|....:|:|                                    ::.|:...|.|..
  Fly    13 GTLGLNLSRAPWDPYP------------------------------------WVSGVQAKSSAER 41

  Fly    74 CGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDKSDEQQAKSDPRSNGYMQAK 138
             |.:::||.:|.|||.||.......:.:.::: .::...|:.|. ....|||..||         
  Fly    42 -GGVRLGDTLLELNGADVLGLKISELANRLQD-HWQSGAEVVTL-MMWRQQANIDP--------- 94

  Fly   139 NKFNQEQTTNNNASGGQGMGQGQGQGQGMAGMNRQQSMQK 178
               |::....::|.              ..|:| |||:||
  Fly    95 ---NEDPAEASHAV--------------QHGIN-QQSLQK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 13/87 (15%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 20/111 (18%)
RING 129..168 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.