DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Zasp66

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:168 Identity:33/168 - (19%)
Similarity:53/168 - (31%) Gaps:56/168 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQ-----TFDKSDEQ 123
            |:...||||  |.|..||.|..:...|.|:.:......|.:.|..:|.|.:.     .:.:...|
  Fly    67 GVQVGSPAH--GELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQ 129

  Fly   124 QAKSDPRSNG-----------------YMQAKNKFNQ---------EQTT--NNNASGGQGMGQG 160
            :|....|||.                 ::...:.|.:         .||.  ..|:|||      
  Fly   130 EAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGG------ 188

  Fly   161 QGQGQGMAGMNRQQSMQKRNTTFTASMRQKHSNYADED 198
                           .:..:|.|:....:.|....||:
  Fly   189 ---------------YEVPSTVFSPKPTRDHQQDVDEE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 16/50 (32%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/48 (31%)
DUF4749 285..359 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.