DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Whrn

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_038965801.1 Gene:Whrn / 313255 RGDID:631330 Length:969 Species:Rattus norvegicus


Alignment Length:226 Identity:58/226 - (25%)
Similarity:100/226 - (44%) Gaps:30/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DLRRIEVQR-DASKPLGLALAGHKDRQKMACFVAGVDPNGALGSVDIKPGDEIVEVNGNVLKNRC 321
            ::|.:.::| .|.:.||.::.|..: ..:..:|:.|:|........::.||:|:.||...|....
  Rat   138 EVRLVSLRRAKAHEGLGFSIRGGSE-HGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVT 201

  Fly   322 HLNASAVFKNVDGDKLVM--ITSRRKP------------NDEGMCVKPIKKFPTASDETKFIFDQ 372
            |..|....|.  ..|||:  .::.|.|            :.:|....|....|..|...:...|:
  Rat   202 HAEAVKALKG--SKKLVLSVYSAGRIPGGYVTNHIYTWVDPQGRSTSPPSSLPHGSTLRQHEDDR 264

  Fly   373 FPKARTVQVRKEGFLGIMVIYGKH--------AEVGSGIFISDLREGSNAELAGVKVGDMLLAVN 429
            ......:|...|..:.:::..|:.        ||.|.||:|:.:..||.||.:|:||||.:|.||
  Rat   265 RSALHLLQSGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAESSGLKVGDQILEVN 329

  Fly   430 QDVTLESNYDDATGLLKRAEGVVTMILLTLK 460
            ....|...:|:|..|||.:.    .::||:|
  Rat   330 GRSFLSILHDEAVKLLKSSR----HLILTVK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 21/83 (25%)
PDZ_signaling 377..457 CDD:238492 27/87 (31%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
WhrnXP_038965801.1 HN_L-whirlin_R1_like 38..113 CDD:259822
PDZ_signaling 139..216 CDD:238492 19/79 (24%)
PDZ_signaling 276..356 CDD:238492 28/83 (34%)
HN_L-whirlin_R2_like 418..498 CDD:259823
PDZ_signaling <908..949 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.