Sequence 1: | NP_001246470.1 | Gene: | inaD / 37629 | FlyBaseID: | FBgn0001263 | Length: | 686 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006229284.1 | Gene: | Ush1c / 308596 | RGDID: | 1303329 | Length: | 910 | Species: | Rattus norvegicus |
Alignment Length: | 328 | Identity: | 70/328 - (21%) |
---|---|---|---|
Similarity: | 128/328 - (39%) | Gaps: | 102/328 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 257 KDLRRIEVQRDASKPLGLALAGHKDRQKMAC--FVAGVDPNGALGSVDIKPGDEIVEVNGNVLKN 319
Fly 320 RCHLNASAVFKNVDGDKLVMITSRRKPNDEGMCVKPIKKFPTASDETKFIFDQF----------- 373
Fly 374 --PKARTVQVRKEGFLGIMVIYGKHAEVGS------GIFISDLREGSNAELAGVKVGDMLLAVNQ 430
Fly 431 DVTLESNYDDATGLLKRAEGVVTMIL---------------------------------LTLKSE 462
Fly 463 EAIK-------------AEKAAEE-----KKKEEAKKEEEKPQ----------------EPATAE 493
Fly 494 IKP 496 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inaD | NP_001246470.1 | PDZ_signaling | 27..115 | CDD:238492 | |
PDZ_signaling | 259..340 | CDD:238492 | 22/82 (27%) | ||
PDZ_signaling | 377..457 | CDD:238492 | 21/118 (18%) | ||
PDZ_signaling | 500..584 | CDD:238492 | |||
PDZ_signaling | 597..672 | CDD:238492 | |||
Ush1c | XP_006229284.1 | harmonin_N | 2..80 | CDD:259819 | |
PDZ_signaling | 85..165 | CDD:238492 | 23/85 (27%) | ||
PDZ_signaling | 209..289 | CDD:238492 | 18/79 (23%) | ||
Cgr1 | <316..>358 | CDD:281823 | 8/41 (20%) | ||
PDZ_signaling | 751..838 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |