DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Ush1c

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_006229284.1 Gene:Ush1c / 308596 RGDID:1303329 Length:910 Species:Rattus norvegicus


Alignment Length:328 Identity:70/328 - (21%)
Similarity:128/328 - (39%) Gaps:102/328 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 KDLRRIEVQRDASKPLGLALAGHKDRQKMAC--FVAGVDPNGALGSVDIKPGDEIVEVNGNVLKN 319
            :.|:.:.:.|...:.|||::.|..:   ..|  |::.:...|...||.::.|||||.:||..:.:
  Rat    83 RKLKEVRLDRLHPEGLGLSVRGGLE---FGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISS 144

  Fly   320 RCHLNASAVFKNVDGDKLVMITSRRKPNDEGMCVKPIKKFPTASDETKFIFDQF----------- 373
            ..|   ..|...:...|.|.|..|.      :.:.|:|..|....:.::: |||           
  Rat   145 CTH---EEVINLIRTKKTVSIKVRH------IGLIPVKSSPEEPLKWQYV-DQFVSESGGVRGGL 199

  Fly   374 --PKARTVQVRKEGFLGIMVIYGKHAEVGS------GIFISDLREGSNAELAGVKVGDMLLAVNQ 430
              |..||.: .|:.|:.::...|....:.|      |||:|:::.||.:...|::.||.::.||.
  Rat   200 SSPGNRTTK-EKKVFISLVGSRGLGCSISSGPIQKPGIFVSNVKPGSLSAEVGLETGDQIVEVNG 263

  Fly   431 DVTLESNYDDATGLLKRAEGVVTMIL---------------------------------LTLKSE 462
            ......::.:|..:||.:..:...|:                                 |.::|.
  Rat   264 IDFTNLDHKEAVNVLKSSRSLTISIVAGAGRELFMTDRERLEEARQHELQRQELLMQKRLAMESN 328

  Fly   463 EAIK-------------AEKAAEE-----KKKEEAKKEEEKPQ----------------EPATAE 493
            :.::             |:|||||     |:.|:..:||||.:                :..|||
  Rat   329 KILQEQQEMERQRRKEIAQKAAEENERYRKEMEQISEEEEKFKKQWEEDWGSKEQLILPKTITAE 393

  Fly   494 IKP 496
            :.|
  Rat   394 VHP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 22/82 (27%)
PDZ_signaling 377..457 CDD:238492 21/118 (18%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Ush1cXP_006229284.1 harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492 23/85 (27%)
PDZ_signaling 209..289 CDD:238492 18/79 (23%)
Cgr1 <316..>358 CDD:281823 8/41 (20%)
PDZ_signaling 751..838 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.