DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Stxbp4

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:90 Identity:23/90 - (25%)
Similarity:49/90 - (54%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 TASDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGSNAELAG-VKVGDM 424
            |:|..:....::.|..|.:.|.||..||:.::.|.....|..::|.::..|.:....| :|.||.
  Rat     5 TSSARSSSPLERDPAFRVITVAKETGLGLKILGGIDRNEGPLVYIHEVTPGGDCYKDGRLKPGDQ 69

  Fly   425 LLAVNQDVTLESNYDDATGLLKRAE 449
            |:::|::..:..::::|..:|.||:
  Rat    70 LVSINKESMIGVSFEEAKNILTRAK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492 20/74 (27%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 19/72 (26%)
TPR_MLP1_2 299..400 CDD:285204
GBP_C <306..389 CDD:303769
coiled coil 359..369 CDD:293879
coiled coil 378..389 CDD:293879
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19964
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.