DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Pdzd7

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001099832.2 Gene:Pdzd7 / 293996 RGDID:1309882 Length:1031 Species:Rattus norvegicus


Alignment Length:224 Identity:59/224 - (26%)
Similarity:96/224 - (42%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 VQRDASKPLGLALAGHKDRQKMACFVAGVDPNGALGSVDIKPGDEIVEVNGNVLKNRCHLNASAV 328
            |::..|..||.::.|..: ..:..||:.|:...:.....:..||:|.||||..|::.  ...|||
  Rat    89 VEKSPSGRLGFSVRGGSE-HGLGIFVSKVEEGSSAERAGLCVGDKITEVNGLSLEST--TMGSAV 150

  Fly   329 FKNVDGDKLVMITSR--RKPNDEGMCVKPIKKFPTASD--ETKFIFDQFPKARTVQVRKEGFLGI 389
            .......:|.|:..|  |.|.     :|..|:..|..|  ..:.:.::.....:....::|...|
  Rat   151 RLLTSSSRLHMMVR
RMGRVPG-----IKFSKEKTTWVDVVNRRLVVEKCSSTPSDSSSEDGVRRI 210

  Fly   390 MVIY--------------GKHAEVGSGIFISDLREGSNAELAGVKVGDMLLAVNQDVTLESNYDD 440
            :.:|              ||  |.|.||::|.:..|..||..|:||||.:||.|.....:.::..
  Rat   211 VHLYTTSDDFCLGFNIRGGK--EFGLGIYVSKVDHGGLAEENGIKVGDQVLAANGVRFDDISHSQ 273

  Fly   441 ATGLLKRAEGVVTMILLTLKSEEAIKAEK 469
            |..:||..    |.|:||:|......|.|
  Rat   274 AVEVLKGQ----THIMLTIKETGRYPAYK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 20/75 (27%)
PDZ_signaling 377..457 CDD:238492 26/93 (28%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Pdzd7NP_001099832.2 PDZ_signaling 84..164 CDD:238492 21/77 (27%)
PDZ_signaling 209..289 CDD:238492 27/85 (32%)
HN_PDZD7_like 555..632 CDD:259824
PDZ_signaling 866..954 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.