Sequence 1: | NP_001246470.1 | Gene: | inaD / 37629 | FlyBaseID: | FBgn0001263 | Length: | 686 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035635.1 | Gene: | Stxbp4 / 20913 | MGIID: | 1342296 | Length: | 557 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 47/228 - (20%) |
---|---|---|---|
Similarity: | 84/228 - (36%) | Gaps: | 71/228 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 361 TASDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGSNAELAG-VKVGDM 424
Fly 425 LLAVNQDVTLESNYDDATGLLKRAE---------------------GVV---------------- 452
Fly 453 TMILLTLKSEEAIKAEKA-------------AEEKKKEEAKKE-------EEKPQEPATAEIK-- 495
Fly 496 -------PNKKI----LIELKVEKKPMGVIVCG 517 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inaD | NP_001246470.1 | PDZ_signaling | 27..115 | CDD:238492 | |
PDZ_signaling | 259..340 | CDD:238492 | |||
PDZ_signaling | 377..457 | CDD:238492 | 21/117 (18%) | ||
PDZ_signaling | 500..584 | CDD:238492 | 7/22 (32%) | ||
PDZ_signaling | 597..672 | CDD:238492 | |||
Stxbp4 | NP_035635.1 | PDZ_signaling | 21..94 | CDD:238492 | 18/72 (25%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 142..214 | 13/71 (18%) | |||
Luteo_P1-P2 | <189..393 | CDD:285641 | 11/44 (25%) | ||
WW | 502..531 | CDD:278809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19964 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |