DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Stxbp4

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_035635.1 Gene:Stxbp4 / 20913 MGIID:1342296 Length:557 Species:Mus musculus


Alignment Length:228 Identity:47/228 - (20%)
Similarity:84/228 - (36%) Gaps:71/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 TASDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGSNAELAG-VKVGDM 424
            |||..:....|:.|..|.:.|.||..||:.::.|.:...|..::|.::..|.:....| :|.||.
Mouse     5 TASARSSSPLDRDPAFRVITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGDCYKDGRLKPGDQ 69

  Fly   425 LLAVNQDVTLESNYDDATGLLKRAE---------------------GVV---------------- 452
            |:::|::..:..::::|..::.||:                     |.:                
Mouse    70 LVSINKESMIGVSFEEAKSIITRAKLRSESPWEIAFIRQKSYCGHPGNICCPSPQVSEDCGPQTS 134

  Fly   453 TMILLTLKSEEAIKAEKA-------------AEEKKKEEAKKE-------EEKPQEPATAEIK-- 495
            |..||:..||..:....:             |.:.|.|..|.|       :..|.:.:.|:|.  
Mouse   135 TFTLLSSPSETLLPKTSSTPQTQDSTFPSCKAIQTKPEHDKTEHSPITSLDNSPADTSNADIAPA 199

  Fly   496 -------PNKKI----LIELKVEKKPMGVIVCG 517
                   |..||    .:.||.||..|.:...|
Mouse   200 WTDDDSGPQGKISLNPSVRLKAEKLEMALNYLG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492 21/117 (18%)
PDZ_signaling 500..584 CDD:238492 7/22 (32%)
PDZ_signaling 597..672 CDD:238492
Stxbp4NP_035635.1 PDZ_signaling 21..94 CDD:238492 18/72 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..214 13/71 (18%)
Luteo_P1-P2 <189..393 CDD:285641 11/44 (25%)
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.