DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and F28E10.4

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_500590.2 Gene:F28E10.4 / 185067 WormBaseID:WBGene00017902 Length:324 Species:Caenorhabditis elegans


Alignment Length:264 Identity:58/264 - (21%)
Similarity:104/264 - (39%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 EIDRASAGNCKLNKQEKDRDKEQEDEFGYTMAKINKRYNMMKDLRR------IEVQRD---ASKP 271
            |:.|.:|.|.::::::           |.|.....:......:||:      ::|:|.   .:..
 Worm    80 ELLRGTACNVEVSRRK-----------GVTPVTCERLAKSGCNLRKGHACFVLDVERPPHMTTTS 133

  Fly   272 LGLALAGHKDRQKMACFVAGVDPNGALGSVDIKPGDEIVEVNG----------NVLKNRCHLNAS 326
            :||.|...|.|    .||..|||| .:.|.....||.|::::|          |.::.  ||:..
 Worm   134 VGLKLGIIKRR----AFVTKVDPN-TIASSFFGCGDSIMDMSGAPIPMTDNPDNFIRE--HLSRL 191

  Fly   327 AVFKNVDGDKLVMITSRRKPNDEGMCVKPIKKF--PTASDETKFIFDQFPKARTVQVRKEGFLGI 389
            :.     |.|:..:..|  |....| .|..:||  ....|:::....|    ..:::.:|.....
 Worm   192 ST-----GAKVSFLVER--PISVAM-AKQYQKFIESITYDDSEVEMAQ----DVIEIGREASNMH 244

  Fly   390 MVIYGKHAEVGSGIFISDL--REGSNAELAGVKVGDMLLA-------VNQDVTLESNYDDATGLL 445
            .:|..|  .|...|..||:  |:.||.:.:....|.:.::       :..|||   ::||    |
 Worm   245 FMILKK--LVTPSILSSDVRRRKKSNNKTSESTEGSITISSASTEMKITSDVT---DFDD----L 300

  Fly   446 KRAE 449
            |..|
 Worm   301 KPVE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 25/99 (25%)
PDZ_signaling 377..457 CDD:238492 19/82 (23%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
F28E10.4NP_500590.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.