DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and ZK849.1

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_493476.1 Gene:ZK849.1 / 173288 WormBaseID:WBGene00014100 Length:331 Species:Caenorhabditis elegans


Alignment Length:134 Identity:29/134 - (21%)
Similarity:56/134 - (41%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LIHMVTLDKTGKKSFG-----------ICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLK- 78
            ||:.:.....|..:|.           :.::|..:......:.||    |.....|..:.|:|| 
 Worm   188 LINRINSSDLGDAAFENGDDWQSSPRLVILMREHINQGLGLEITG----GCDQFRPVVVTGKLKR 248

  Fly    79 ---------VGDRILSLNGKDVRNSTEQA-VIDLIKEADFK--IELEIQTFDKSDEQQAKSDPRS 131
                     |.||||:::|..|.|:|..| |:::::....|  |.|.:..||.:...:|..:.:.
 Worm   249 SMADDDQLRVNDRILAIDGTFVTNTTTHAEVMEMLENESAKDFISLIVSQFDPTKYHEAHPNGKC 313

  Fly   132 NGYM 135
            :.::
 Worm   314 HKFV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 25/111 (23%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
ZK849.1NP_493476.1 PDZ_signaling 212..296 CDD:238492 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.