Sequence 1: | NP_001246470.1 | Gene: | inaD / 37629 | FlyBaseID: | FBgn0001263 | Length: | 686 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492164.1 | Gene: | gras-1 / 172549 | WormBaseID: | WBGene00009272 | Length: | 245 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 39/201 - (19%) |
---|---|---|---|
Similarity: | 76/201 - (37%) | Gaps: | 45/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 KTGKKSFGICIVRGEVK-DSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQ 97
Fly 98 AVIDLIKEADFKIELEIQTFDKSDEQQAKSDPRSNGYMQAKNKFNQEQTTNNNASGGQGMGQGQG 162
Fly 163 QGQGMAGMNRQQSMQKRNTTFTASMRQKHSNYADEDDEDTRDMTGRIRTEAGYEIDRASAGNCKL 227
Fly 228 NKQEKD 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inaD | NP_001246470.1 | PDZ_signaling | 27..115 | CDD:238492 | 19/81 (23%) |
PDZ_signaling | 259..340 | CDD:238492 | |||
PDZ_signaling | 377..457 | CDD:238492 | |||
PDZ_signaling | 500..584 | CDD:238492 | |||
PDZ_signaling | 597..672 | CDD:238492 | |||
gras-1 | NP_492164.1 | PDZ | 67..145 | CDD:238080 | 18/81 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |