DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and smz-2

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_491965.1 Gene:smz-2 / 172415 WormBaseID:WBGene00020661 Length:274 Species:Caenorhabditis elegans


Alignment Length:273 Identity:59/273 - (21%)
Similarity:104/273 - (38%) Gaps:59/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 IFISDLREGSNAELAGVKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTLKSEEAIKA 467
            :.|:.::.|:.:| ..:::||.:..||     ..|..|.....:..........:|:.       
 Worm    27 LVITKIQAGTISE-GKLRIGDQVKKVN-----GQNCKDCNDFFRALRFAAPCAKITVN------- 78

  Fly   468 EKAAEEKKKEEAKKEEEKPQEPATAEIKPNKKILIELK----VEKKP---MGVIVCGGKNNHVTT 525
               .:|||.||.:.....|::.|.. |:..:..:.||.    |:..|   :|:       .|...
 Worm    79 ---RDEKKAEELEARVHIPEDRAKI-IQRREGYVYELATLVWVQNGPKLGLGI-------KHFQN 132

  Fly   526 GCVITHVYPEGQVAADKRLKIFDHICDINGTPIHVGSMTTLKVHQLFHTTYEKA-VTLTVFRADP 589
            ..:::.|.| |.: |:|.|.:.||:||::|.|:   |...:....|.....||. ||..|.|.| 
 Worm   133 RVLVSRVDP-GSL-AEKCLVLGDHLCDVDGIPV---SDKDVARDLLVKNIQEKGKVTFVVERPD- 191

  Fly   590 PELEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEGLPF 654
                  ::|..:.|.:.|..:|.              |.|.:........|.:::. .||.||..
 Worm   192 ------SIDAKQWAKQALATNLM--------------QPPSVQMNEDVKGIASQYR-QALPGLKP 235

  Fly   655 QVCYALFKGANGK 667
            ....|:..|.|.:
 Worm   236 PAKSAMSTGPNAR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492 9/53 (17%)
PDZ_signaling 500..584 CDD:238492 24/91 (26%)
PDZ_signaling 597..672 CDD:238492 14/71 (20%)
smz-2NP_491965.1 PDZ_signaling 7..77 CDD:238492 9/55 (16%)
PDZ_signaling 114..188 CDD:238492 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.