DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment inaD and Grid2ip

DIOPT Version :9

Sequence 1:	NP_001246470.1	Gene:	inaD / 37629	FlyBaseID:	FBgn0001263	Length:	686	Species:	Drosophila melanogaster
Sequence 2:	NP_001152793.1	Gene:	Grid2ip / 170935	MGIID:	2176213	Length:	1203	Species:	Mus musculus

Alignment Length:	69	Identity:	27/69 - (39%)
Similarity:	39/69 - (56%)	Gaps:	11/69 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    36 GKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVI 100
            |.||||..: ||.   .|      ::|:.::|.|||.... ||.|||||.|||.|:||.:...|:
Mouse   274 GNKSFGFTL-RGH---GP------VWIESVLPGSPAENAS-LKSGDRILFLNGLDMRNCSHDKVV 327

  Fly   101 DLIK 104
            .:::
Mouse   328 SMLQ 331

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
inaD	NP_001246470.1	PDZ_signaling	27..115	CDD:238492	27/69 (39%)
		PDZ_signaling	259..340	CDD:238492
		PDZ_signaling	377..457	CDD:238492
		PDZ_signaling	500..584	CDD:238492
		PDZ_signaling	597..672	CDD:238492
Grid2ip	NP_001152793.1	PDZ_signaling	9..69	CDD:238492
		HN_L-delphilin-R1_like	122..201	CDD:259820
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	215..270
		PDZ_signaling	269..342	CDD:238492	27/69 (39%)
		HN_L-delphilin-R2_like	378..457	CDD:259821
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	466..541
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	563..586
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	611..656
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	710..821
		FH2	812..1180	CDD:280362
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900