DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Pdzd3

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_573489.2 Gene:Pdzd3 / 170761 MGIID:2429554 Length:498 Species:Mus musculus


Alignment Length:319 Identity:72/319 - (22%)
Similarity:136/319 - (42%) Gaps:46/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 GALGSVDIKPGDEIVEVNGNVLKNRCHLNASAVFKNV--DGDKLVMITSRRKPNDE----GMCVK 354
            ||.....:.||..::||||..::.   |..:.:.:.:  .||::.::.:..:..::    ||   
Mouse   187 GAAERAGVPPGARLLEVNGASVEK---LTYNQLNRKLWQSGDQVTLLVAGLEVEEQCHQLGM--- 245

  Fly   355 PIKKFPTASDETK-FIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGSNAELAG 418
                 |.|:...: :.....|:...::...||| |.::...|..:...|.|:.|:..|..|:.||
Mouse   246 -----PLAAPLAEGWALPAKPRCLNIEKGPEGF-GFLLREEKGLDGRLGQFLWDVDPGLPADKAG 304

  Fly   419 VKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTLKSEEAIKAEKAAEEKKKEEAKKEE 483
            :|.||.|:||..:......:::....::.....|::|::..:::......:.:.....|..    
Mouse   305 MKAGDRLVAVAGESVDGLGHEETVSRIRAQGSCVSLIVVDPEADRFFSMVRLSPLLFLENT---- 365

  Fly   484 EKPQEPATAEIKPNKKILIELKVEKKPM-GVIVC-------GGKNNH---VTTG-CV-ITHVYPE 535
                |.|...:...|.:.:|..||...: |...|       ||....   |.:| |: |:.|.|.
Mouse   366 ----EIAAPPLAETKDLPVEDTVEPSGLAGSCQCFLYPGPGGGYGFRLCCVASGPCLFISQVTPG 426

  Fly   536 GQVAADKRLKIFDHICDINGTPIHVGSMTTL-KVHQLFHTTYEKAVTLTVFRADPPELE 593
            |. ||...|::.|.:.::||.|  ||..:.| ::.||  |..|..:.|.:...:|..||
Mouse   427 GS-AARAGLQVGDTVLEVNGYP--VGGDSELDRLQQL--TEAEPPLCLKLGARNPQGLE 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 11/45 (24%)
PDZ_signaling 377..457 CDD:238492 20/79 (25%)
PDZ_signaling 500..584 CDD:238492 29/97 (30%)
PDZ_signaling 597..672 CDD:238492
Pdzd3NP_573489.2 PDZ_signaling 47..127 CDD:238492
PDZ_signaling 155..232 CDD:238492 11/47 (23%)
PDZ 260..345 CDD:214570 21/85 (25%)
PDZ_signaling 407..471 CDD:238492 22/68 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.