DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaD and Il16

DIOPT Version :9

Sequence 1:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001347016.1 Gene:Il16 / 16170 MGIID:1270855 Length:1424 Species:Mus musculus


Alignment Length:569 Identity:113/569 - (19%)
Similarity:209/569 - (36%) Gaps:129/569 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QQSMQKRNTTFTASMRQKHSNYADEDDEDTRDMTGRIRTEAGYEIDRA-SAGNCKLNKQEKDRDK 236
            :|..:||.  .|:|:|.:...::.:..:.|:..:          |.|: ...|.|.:......|:
Mouse    89 EQERKKRG--LTSSLRMEPHGHSGKSRKSTKFRS----------ISRSLILCNAKTSDDGSSPDE 141

  Fly   237 EQEDEF---------GYTMAKINKRYNMMKDLRRIEVQRDASKPLGLALAGHKDRQKMACFVAGV 292
            :..|.|         |:..:.:.........|..|.....||....||.|| .||.|....:..:
Mouse   142 KYPDPFETSLCQGKEGFFHSSMQLADTFEAGLSNIPDLALASDSAQLAAAG-SDRGKHCRKMFFM 205

  Fly   293 DPNGALGSVDIKPGDEIVEVNGNVLKNRCH----LNASAVFKNVDGD-KLVMITSRRKPNDE--- 349
            ..:.:..|.: |.|....:.:..:....||    .|:::|.....|: ...|......|.|.   
Mouse   206 KESSSTSSKE-KSGKPEAQSSSFLFPKACHQRTRSNSTSVNPYSAGEIDFPMTKKSAAPTDRQPY 269

  Fly   350 GMC-----------------VKPIKKFPTASDETKFIFDQFPKARTVQV---------RKEGFLG 388
            .:|                 .:|.:...||.      ..|........|         :.:| ||
Mouse   270 SLCSNRKSLSQQLDYPILGTARPTRSLSTAQ------LGQLSGGLQASVISNIVLMKGQAKG-LG 327

  Fly   389 IMVIYGKHAEVGS-GIFISDLREGSNAELAG-VKVGDMLLAVNQDVTLESNYDDATGLLKRA-EG 450
            ..::.||.:..|. ||::..:..|..|...| ::.||.:|.:|.:......:.||....|:| :|
Mouse   328 FSIVGGKDSIYGPIGIYVKSIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKG 392

  Fly   451 VVTMILLTL----------KSEEAIKAEKAAEEKKKEEAKKEEEKPQEPATAEIKPNKKILIELK 505
            ::|:.:.|.          .|....::..::....::.:....|.|..||:. .|||.:|::|:.
Mouse   393 LLTLTVRTRLTTPPSLCSHLSPPLCRSLSSSTCGAQDSSPFSLESPASPAST-AKPNYRIMVEVS 456

  Fly   506 VEKKP---MGVIVCGGKNNHVTTGCVITHVYPEGQVA-ADKRLKIFDHICDINGTPIHVGSMTTL 566
            ::|:.   :|:.:|........:| :..|....|.|| .|.||:..|.|.:||.:|:|  .:|..
Mouse   457 LKKEAGVGLGIGLCSIPYFQCISG-IFVHTLSPGSVAHLDGRLRCGDEIVEINDSPVH--CLTLN 518

  Fly   567 KVHQLFHTTYEKAVTLTVFRADPPELEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEI 631
            :|:.:........|.:.|.|...|::.:   ..:|:|                :|..::|     
Mouse   519 EVYTILSHCDPGPVPIIVSRHPDPQVSE---QQLKEA----------------VAQAVEG----- 559

  Fly   632 DSKLQRGDIITKFNGD----ALEGLPFQVCYALFKGANGKVSMEVTRPK 676
                      .||..|    :|||:.     .|....:|:.::|..|.|
Mouse   560 ----------VKFGKDRHQWSLEGVK-----RLESSWHGRPTLEKEREK 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492 19/85 (22%)
PDZ_signaling 377..457 CDD:238492 22/91 (24%)
PDZ_signaling 500..584 CDD:238492 22/87 (25%)
PDZ_signaling 597..672 CDD:238492 12/78 (15%)
Il16NP_001347016.1 PDZ_signaling 316..391 CDD:238492 19/75 (25%)
PDZ_signaling 454..536 CDD:238492 21/84 (25%)
Atrophin-1 <620..931 CDD:331285
PDZ_signaling 1206..1283 CDD:238492
PDZ_signaling 1328..1409 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.