DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and RPL23B

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_011042.3 Gene:RPL23B / 856853 SGDID:S000000919 Length:137 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:106/139 - (76%)
Similarity:119/139 - (85%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATV 65
            ||..|..||   ||||||||||||:||||||:||:|||:|||.|...||||||||.:|||.:|||
Yeast     1 MSGNGAQGT---KFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATV 62

  Fly    66 KKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWP 130
            ||||||||||||||:|:||.|.:|||||||:|||||||||.|.|||||||||||||.||||||||
Yeast    63 KKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWP 127

  Fly   131 RIASNASSI 139
            |:|||:..:
Yeast   128 RVASNSGVV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 105/136 (77%)
RPL23BNP_011042.3 PTZ00054 5..137 CDD:185418 104/135 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346282
Domainoid 1 1.000 196 1.000 Domainoid score I593
eggNOG 1 0.900 - - E1_COG0093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68103
Inparanoid 1 1.050 217 1.000 Inparanoid score I782
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62196
OrthoFinder 1 1.000 - - FOG0001452
OrthoInspector 1 1.000 - - otm46896
orthoMCL 1 0.900 - - OOG6_100370
Panther 1 1.100 - - LDO PTHR11761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1119
SonicParanoid 1 1.000 - - X1955
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.