DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and AT5G46160

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_851140.1 Gene:AT5G46160 / 834658 AraportID:AT5G46160 Length:173 Species:Arabidopsis thaliana


Alignment Length:156 Identity:45/156 - (28%)
Similarity:70/156 - (44%) Gaps:39/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKRGRGGTA-------GGKFRISLG----------------LPVGAVMNCADNTGAKNLYVIAVH 43
            |:..|||.:       ||....|.|                :.:|.|:...||:|||.  |:.:.
plant     7 SRLTRGGRSLLGGLNNGGSMNSSNGMMNESILSQQQQRRTFIQMGTVLKVVDNSGAKK--VMCIQ 69

  Fly    44 GIRGRLNRLPAAGVGDMFVATVKKGKPELRKK---VMPAVVIRQRKPFRRRDGVFIYFEDNAGVI 105
            .::|:    ..|.:||..||:||:..|..:.|   |:..||:|......|.||..:.|:|||.|:
plant    70 ALKGK----KGARLGDTIVASVKEAMPNGKVKKGAVVYGVVVRAAMQRGRVDGSEVRFDDNAVVL 130

  Fly   106 VNNKGEMK-------GSAITGPVAKE 124
            |::|.:..       |:.:.|||..|
plant   131 VDSKDKNTKTDRQPIGTRVFGPVPHE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 45/156 (29%)
AT5G46160NP_851140.1 Ribosomal_L14 48..172 CDD:278659 37/115 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0093
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001452
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100370
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.