DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and AT2G33370

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_180895.1 Gene:AT2G33370 / 817900 AraportID:AT2G33370 Length:140 Species:Arabidopsis thaliana


Alignment Length:139 Identity:112/139 - (80%)
Similarity:130/139 - (93%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATV 65
            |||||||||:|.|||:||||||.|.:||||||||||||:|:|.||:|||||||:|.||||.:|||
plant     1 MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATV 65

  Fly    66 KKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWP 130
            |||||:|||||:|||::|||||:||:||||:|||||||||||.||||||||||||:.||||||||
plant    66 KKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWP 130

  Fly   131 RIASNASSI 139
            ||||.|::|
plant   131 RIASAANAI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 110/136 (81%)
AT2G33370NP_180895.1 PTZ00054 2..140 CDD:185418 111/138 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I873
eggNOG 1 0.900 - - E1_COG0093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68103
Inparanoid 1 1.050 238 1.000 Inparanoid score I1097
OMA 1 1.010 - - QHG62196
OrthoDB 1 1.010 - - D1374830at2759
OrthoFinder 1 1.000 - - FOG0001452
OrthoInspector 1 1.000 - - oto2876
orthoMCL 1 0.900 - - OOG6_100370
Panther 1 1.100 - - O PTHR11761
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1955
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.