DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and rpl2301

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_594075.1 Gene:rpl2301 / 2543453 PomBaseID:SPAC3G9.03 Length:139 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:102/136 - (75%)
Similarity:122/136 - (89%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATVKKG 68
            ||||..:|.|:|::|||||.|:||||||:||||||:::|.|...||||||||..|||.:||||||
pombe     3 RGRGAASGTKYRMTLGLPVQAIMNCADNSGAKNLYIVSVFGTGARLNRLPAASCGDMVLATVKKG 67

  Fly    69 KPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIA 133
            ||:||||:|||:|:||||.:||:|||::|||||||||||.|||||||||||||||||||||||||
pombe    68 KPDLRKKIMPAIVVRQRKAWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWPRIA 132

  Fly   134 SNASSI 139
            |||.::
pombe   133 SNAGTV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 102/134 (76%)
rpl2301NP_594075.1 PTZ00054 1..139 CDD:185418 102/136 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I689
eggNOG 1 0.900 - - E1_COG0093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68103
Inparanoid 1 1.050 221 1.000 Inparanoid score I903
OMA 1 1.010 - - QHG62196
OrthoFinder 1 1.000 - - FOG0001452
OrthoInspector 1 1.000 - - otm47345
orthoMCL 1 0.900 - - OOG6_100370
Panther 1 1.100 - - LDO PTHR11761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1955
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.