DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and mrpl38

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_596481.2 Gene:mrpl38 / 2541232 PomBaseID:SPBC887.07 Length:136 Species:Schizosaccharomyces pombe


Alignment Length:132 Identity:42/132 - (31%)
Similarity:61/132 - (46%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGLPVGAVMNCADNTGAKNLYVIAVHGIR-GRLNRLPAAGVGDMFVATVKKGK---------PEL 72
            :||.  .::...||:||.....|.|  :| |:.     |.:||..|..|||.:         ...
pombe    12 IGLK--GILKVIDNSGATLAECIRV--VRAGKF-----ASLGDEVVVVVKKARSGSSVTAANKVK 67

  Fly    73 RKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKE--------CADLW 129
            |..:..|:::|.:.|.||.||.::.|:|||.|:||.:.|..|:.|...||.|        .|.|.
pombe    68 RGDIHHAIIVRTKSPVRRPDGRYVRFDDNACVLVNKECEPLGTRILSVVANELRTKHHTKIASLA 132

  Fly   130 PR 131
            ||
pombe   133 PR 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 42/132 (32%)
mrpl38NP_596481.2 Ribosomal_L14 12..134 CDD:278659 40/130 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0093
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001452
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100370
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.