DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and rpl-23

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_498231.1 Gene:rpl-23 / 175796 WormBaseID:WBGene00004435 Length:140 Species:Caenorhabditis elegans


Alignment Length:140 Identity:123/140 - (87%)
Similarity:132/140 - (94%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATV 65
            ||||||||.:|.|||||||||||||||||||||||||:||:|:||||||||||:||||||||.:|
 Worm     1 MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDMFVCSV 65

  Fly    66 KKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWP 130
            |||||||||||:..|||||||.|||:||.||||||||||||||||||||||||||||||||||||
 Worm    66 KKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWP 130

  Fly   131 RIASNASSIA 140
            |||:||.|||
 Worm   131 RIAANAGSIA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 119/136 (88%)
rpl-23NP_498231.1 PTZ00054 2..139 CDD:185418 119/136 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166810
Domainoid 1 1.000 215 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_COG0093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68103
Inparanoid 1 1.050 253 1.000 Inparanoid score I1974
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62196
OrthoDB 1 1.010 - - D1374830at2759
OrthoFinder 1 1.000 - - FOG0001452
OrthoInspector 1 1.000 - - oto18624
orthoMCL 1 0.900 - - OOG6_100370
Panther 1 1.100 - - LDO PTHR11761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1119
SonicParanoid 1 1.000 - - X1955
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.