DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23 and LOC108350588

DIOPT Version :9

Sequence 1:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_017447849.1 Gene:LOC108350588 / 108350588 RGDID:11504759 Length:142 Species:Rattus norvegicus


Alignment Length:138 Identity:96/138 - (69%)
Similarity:118/138 - (85%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATVKK 67
            |:.|||::|.||||||||.||||:|.||:||.||:|:|:|..|:|||:||||||||.|.:|||:|
  Rat     5 KQRRGGSSGAKFRISLGLQVGAVINRADSTGTKNVYIISVKEIKGRLDRLPAAGVGHMVMATVQK 69

  Fly    68 GKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRI 132
            .:|:|||||.||:||||:|...|:|||.:|||::|.|||||||:|||||||||:|||.||.||||
  Rat    70 SRPQLRKKVHPAMVIRQQKSCGRKDGVSLYFEEDAEVIVNNKGKMKGSAITGPIAKEHADSWPRI 134

  Fly   133 ASNASSIA 140
            ||||.|.|
  Rat   135 ASNAGSTA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 94/135 (70%)
LOC108350588XP_017447849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1374830at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.