DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB15 and ypt2

DIOPT Version :9

Sequence 1:NP_001295083.1 Gene:RAB15 / 376267 HGNCID:20150 Length:212 Species:Homo sapiens
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:97/187 - (51%)
Similarity:136/187 - (72%) Gaps:8/187 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     3 KQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQ 67
            |.||.|.:|||||||||||:|||.||:::.|..|.|:|||:|||::|||:||.::::||||||||
pombe     4 KSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQ 68

Human    68 ERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVG 132
            ||::|||..|||.|.||.|:||::.::|:.::..|.|:|:::|.|.|.|||||||.|.|.:|||.
pombe    69 ERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQRQVS 133

Human   133 REQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELEGLRMRASNELA 189
            .||||.||.|.|:.|.|.||.||:|:.|:|..|.        :|::..::.|.||.:
pombe   134 FEQGQALADELGVKFLEASAKTNVNVDEAFFTLA--------REIKKQKIDAENEFS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB15NP_001295083.1 Rab15 9..172 CDD:206698 89/162 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..212
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 92/173 (53%)
Ras 11..172 CDD:278499 90/168 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.