DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and YOL162W

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:50/239 - (20%)
Similarity:93/239 - (38%) Gaps:59/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALP-FVVMLMSSYGFIFLAEYLTRRR 319
            :||:...:...::.||:      :..|...:..||.|  |:| ||:.::..:|..:..|....|.
Yeast     3 LLAYIPTNVLATYLTLV------LRSIGFTTFQANLL--AIPNFVLHILLLFGLTWSTEKCNNRL 59

  Fly   320 DISL-------PIL------RKTINSFATW-TPAVALVILS--YVSDQNVVGSMFCLIAATAAIS 368
            .:||       |:|      :.|:  |..| |.|:..:||.  |:                    
Yeast    60 GLSLLQPLYTVPLLAVLRFWKGTM--FNKWGTYAIITLILDNPYI-------------------- 102

  Fly   369 GQAIGSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESDRSQWRT---VFLGISV 430
             .||..||    .|.|...:.....:|.:....|.:.::|...:..:||...:|.   |..|:::
Yeast   103 -HAICVSL----CSRNSQSVKTRTVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKGNGVLFGLAL 162

  Fly   431 ILF---LGN-LMYLIFGQMTVQSWNDSPSKETETEASPKPQASA 470
            .:|   :|: |:|:...:...:.||....:|.:...|....|.:
Yeast   163 FMFPILIGSKLIYVYINKQRDKRWNAMSEEEKDHYLSTTSDAGS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 45/209 (22%)
2A0114euk 23..458 CDD:129972 47/225 (21%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 42/200 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.