DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and YOL163W

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_014479.1 Gene:YOL163W / 854001 SGDID:S000005523 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:24/107 - (22%)
Similarity:41/107 - (38%) Gaps:35/107 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 VPWLQILTSRPFIVLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYG 307
            :.|..:.|.:       |||:...||||.     |.:.|:|.....|:        :|:.||   
Yeast     2 IAWSLVATLQ-------CKMTGKSSFYTC-----RALMGLFEGGFVAD--------LVLWMS--- 43

  Fly   308 FIFLAEYLTRRRDISLPILRKTINSFATWTPAVALVILSYVS 349
                  |.....::|:.:      ||...|.::..:|.|.|:
Yeast    44 ------YFYSSSELSIRL------SFFWVTLSLTQIITSIVA 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 24/107 (22%)
2A0114euk 23..458 CDD:129972 24/107 (22%)
YOL163WNP_014479.1 MFS 1..>151 CDD:421695 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.