DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and TNA1

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_011776.1 Gene:TNA1 / 853175 SGDID:S000003492 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:410 Identity:86/410 - (20%)
Similarity:153/410 - (37%) Gaps:99/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 WGSCCTQMMSGY-LSSRFGAKVLLLTIMLLTALLSI------ATPFALAW-GGWQLLFWVRFVQG 131
            :.:|.|...:.| |....|..  ||.||....::||      |.....|| ..:..|..||.:.|
Yeast   129 YNTCVTVFFATYVLFDPIGTN--LLKIMGPPLMMSICLTCFGAISLGTAWVKNYAQLIVVRLLLG 191

  Fly   132 LAMGGMWPCLYTHLAKWCPKKE---------------ANRMGGIMTTGLDCGTIMGFALSGVLSA 181
            ...|.::|.:..:|:. |.::|               ::..||::..|  |..|.|         
Yeast   192 AFEGMIYPAINMYLSV-CYRREQYALRFAFVFSAACLSSSFGGLIAYG--CSKISG--------- 244

  Fly   182 SPLGWPSTFYVPGYLGIVWCLTFLRYG-ANSPSESKFISLAERKHIQFALEQNQVIRGATP--PV 243
            |...|...:.|.|.:.:.: :.|..:| :.:..:|.|.:..|:::|.   |:.:.:....|  ..
Yeast   245 SLKDWQYIYIVEGCISLGF-VPFYAFGLSKNLEDSWFFNKEEKEYIS---ERYKTMNTFDPDEKF 305

  Fly   244 PWLQILTSRPFIVLAFCKMSQACSFYTLMQQIPRYIHGI--FHYSIAANALLSALPFVVMLMSSY 306
            .|.|:                    :..::.:..:...:  |...:....|...||.::   :|.
Yeast   306 EWFQV--------------------WQAVKDVKTWASAVALFGIDLTTFGLTVFLPIII---TSM 347

  Fly   307 GFIFLAEYLTRRRDISLPILRKTINSFATWTPAVALVILSYVSDQNVVGSMFCLIAATAAISGQA 371
            ||..:     |.:.:::||.      |.|   |:...|.:..||:..:.|.|.|.|......|.|
Yeast   348 GFTNV-----RAQLMTVPIY------FLT---AIVFFICAVWSDRIKLRSPFILGACLTTSIGIA 398

  Fly   372 I--GSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISVILFL 434
            |  ||.::.|    .:.|:........::||      ...|.::..:.....|...|||:  ||.
Yeast   399 IVLGSQVHGV----RYFGVYILCMGIYVNAA------CNCLWLSGNTGNYFKRATALGIN--LFF 451

  Fly   435 GNLMYLIFGQMTVQSWNDSP 454
            |:...|:.||:.|.  .|.|
Yeast   452 GSGSGLVSGQIFVA--KDKP 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 81/396 (20%)
2A0114euk 23..458 CDD:129972 86/410 (21%)
TNA1NP_011776.1 MFS_FEN2_like 87..490 CDD:340885 86/410 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.