DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and VHT1

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:80/400 - (20%)
Similarity:135/400 - (33%) Gaps:114/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQVLFLFLCATLIVAQRFNMSVAIVAFTNANSSNPNYPEYRLTEPQKSYTISSPFWGSCCTQMMS 84
            :.:.|..||        ::.||.:..:|||..||.. .:..:......||.:....|:...|:..
Yeast   129 IALYFFMLC--------WSKSVDLNNYTNAYVSNMK-EDLNMKGNDYVYTSTIANVGAIVFQLPF 184

  Fly    85 GYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFW----------------VRFVQGLA 133
            .||..||.:.::|..:.|                ||.   |                .||:....
Yeast   185 MYLLPRFPSHIILPVMDL----------------GWT---WFTFACYRANSLAELRAYRFILSAF 230

  Fly   134 MGGMWPCLYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSA----------SPLGWPS 188
            ....:|.....|..|....|.|....:..    ||..:|...||:|.:          ...||..
Yeast   231 GAAYYPVSQYILGCWYAPDEINSRVCLFF----CGQQLGSVTSGLLQSRIFKSLNGVHGLAGWRW 291

  Fly   189 TFYV--------PGYLGIVWCLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGA----TP 241
            .|.:        ...:|.     |:..|..|...|.|::..|.:..:...::||:..|.    ..
Yeast   292 MFLIDAIAISLPTAIIGF-----FVIPGVPSKCYSLFLTDEEIRIARARNKRNQIKDGVDKSKLA 351

  Fly   242 PVPWLQILTSRPFIVLAF--------CKMSQACSF---YTLMQQIPRYIHGIFHYSIAANALLSA 295
            |: |.:.|..:.|...||        |..:...::   |||      ::.....||||....||.
Yeast   352 PL-WSRKLWKKVFCTPAFWVLVVFDTCSWNNMTAYSGSYTL------WLKSNTKYSIAQVNNLSV 409

  Fly   296 LP----FVVMLMSSYG-------FIFLAEYLTRRRDISLPILRK-TINSFATW--------TPAV 340
            :|    |..::..::|       :||:. :......:|..:|.| .|.|.|.|        :.|.
Yeast   410 IPACLGFAYVIFCAFGADLFRCKWIFMV-FAAIMNTVSCALLIKWDIPSKAKWYAFFTTYFSVAA 473

  Fly   341 ALVILSYVSD 350
            :..:.|:::|
Yeast   474 SPCLWSFIND 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 79/397 (20%)
2A0114euk 23..458 CDD:129972 79/396 (20%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 79/399 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I2980
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.