DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and Slc17a6

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_445879.1 Gene:Slc17a6 / 84487 RGDID:620531 Length:582 Species:Rattus norvegicus


Alignment Length:446 Identity:134/446 - (30%)
Similarity:225/446 - (50%) Gaps:39/446 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RFNMSVAIVAFTNANS-----------SNPNYPEYRLTEPQKSYTI-SSPFWGSCCTQMMSGYLS 88
            |.|:.||||...|.::           :..|:      :|:....| .|.|||...||:..||::
  Rat    88 RCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW------DPETVGMIHGSFFWGYIITQIPGGYIA 146

  Fly    89 SRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKWCPKKE 153
            ||..|..:....:|||:.|::..|.| |...:..:.:||.:|||..|..:|..:...:||.|..|
  Rat   147 SRLAANRVFGAAILLTSTLNMLIPSA-ARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLE 210

  Fly   154 ANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFLRYGANSPSESKFI 218
            .:|:......|...|.::...|:|:| ....||.|.|||.|..|:||.:.:|.....||::...|
  Rat   211 RSRLATTSFCGSYAGAVIAMPLAGIL-VQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTI 274

  Fly   219 SLAERKHIQFALEQNQVIRGATP--PVPWLQILTSRP---FIVLAFCKMSQACSFYTLMQQIPRY 278
            :..||::|:.::.::..:.||..  ..||.:..||.|   .||..||:   :.:||.|:...|.|
  Rat   275 TDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCR---SWTFYLLLISQPAY 336

  Fly   279 IHGIFHYSIAANALLSALPFVVM--LMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVA 341
            ...:|.:.|:...:|||:|.:||  ::...|.|  |::|..::.:|...:||.:|.......|..
  Rat   337 FEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQI--ADFLRSKQILSTTTVRKIMNCGGFGMEATL 399

  Fly   342 LVILSYVSDQNVVGSMFCLIAATAAISGQAI-GSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISP 405
            |:::.|...:.|..|...|   ....||.|| |.::||:|::|.:|.:|.|:||.:.:.:|::.|
  Rat   400 LLVVGYSHTRGVAISFLVL---AVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCP 461

  Fly   406 IVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWNDSPSKETETE 461
            |::| .:||...|.:|:.|||..:::.:.|.:.|.:|.....|.|.|  .:||..|
  Rat   462 IIVG-AMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWAD--PEETSEE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 127/425 (30%)
2A0114euk 23..458 CDD:129972 131/441 (30%)
Slc17a6NP_445879.1 2A0114euk 70..511 CDD:129972 131/441 (30%)
MFS 75..498 CDD:119392 127/426 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.