DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and SLC17A9

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_071365.4 Gene:SLC17A9 / 63910 HGNCID:16192 Length:436 Species:Homo sapiens


Alignment Length:439 Identity:116/439 - (26%)
Similarity:196/439 - (44%) Gaps:64/439 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LFLCATLIVAQRFNMSVAIVAFTNANSSNPNYPEYRLTEPQKSYTISSPFWGSCCTQMMSGYLSS 89
            |.|...|:...|.:|.:..|:.:.         ::...:.:....:||.|||.|.||::.|:|..
Human    30 LLLGTCLLYCARSSMPICTVSMSQ---------DFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGD 85

  Fly    90 RFGA-KVLLL------TIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAK 147
            |.|. ||:||      :|..:|.||:..:...||:     :.:.|.:.||..|..:|.|.:.|::
Human    86 RIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAF-----MTFSRILMGLLQGVYFPALTSLLSQ 145

  Fly   148 WCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFLRYGANSP 212
            ...:.|......|:..|...||::..|: |.|.....||.|.||..|.|.::|.....||     
Human   146 KVRESERAFTYSIVGAGSQFGTLLTGAV-GSLLLEWYGWQSIFYFSGGLTLLWVWYVYRY----- 204

  Fly   213 SESKFISLAERKHIQFALEQNQVIRGATP-----PVPWLQILTSRPFIVLAFCKMSQACSFYTLM 272
                   |...|.:..||   .|:..:.|     .|||.::............::|.||||:.|:
Human   205 -------LLSEKDLILAL---GVLAQSRPVSRHNRVPWRRLFRKPAVWAAVVSQLSAACSFFILL 259

  Fly   273 QQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYGFIFLAEYLTRR--RDISLPILRKTINSFAT 335
            ..:|.:....|  ..|...:.:.:|::|.:.:|....||:::|..:  |.|:   :||.:.....
Human   260 SWLPTFFEETF--PDAKGWIFNVVPWLVAIPASLFSGFLSDHLINQGYRAIT---VRKLMQGMGL 319

  Fly   336 WTPAVALVILSYVSDQNVVGSMFC--LIAATAAISGQAI---GSSLNHVDLSPNFAGLLFGMSNT 395
            ...:|..:.|.:.|.       ||  ::.|:|:|..|..   |.|:|..||:|:.||.|||::||
Human   320 GLSSVFALCLGHTSS-------FCESVVFASASIGLQTFNHSGISVNIQDLAPSCAGFLFGVANT 377

  Fly   396 LMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQ 444
            ..:.|||:...:.|..:   .....|..:|..:::|..||...:|:|||
Human   378 AGALAGVVGVCLGGYLM---ETTGSWTCLFNLVAIISNLGLCTFLVFGQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 113/435 (26%)
2A0114euk 23..458 CDD:129972 116/439 (26%)
SLC17A9NP_071365.4 MFS_1 44..386 CDD:311564 102/383 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.