DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and CG18788

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster


Alignment Length:443 Identity:106/443 - (23%)
Similarity:174/443 - (39%) Gaps:91/443 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KSYTISSPFWGSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQ 130
            :|..:.:.:.|...:.:..|.|:.|:|.|.:|...:|.:|:|::.||.|:..||...|..||.:.
  Fly   140 QSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVAVRLLV 204

  Fly   131 GLAMGGMWPCLYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGY 195
            |:..|..:|.:...||:|.|::|...:...:.:|.:.|..|...:||:|.|.. .||..||:.|.
  Fly   205 GICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQ-DWPVFFYLVGG 268

  Fly   196 LGIVWCLTFLRYGANSPSESKFISLAERKHIQ------FAL--------------------EQNQ 234
            ..:.|.|.|.....::|....||...||::|:      |.|                    |..:
  Fly   269 GAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGEDREHRR 333

  Fly   235 VIRGATPPVPWLQILTSRPFIVLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALPFV 299
            .:.......||..:|.|.|...|....|.|     ...|::|:.:........|.....|.|..:
  Fly   334 EVEATCNTAPWRSMLNSTPLWALVSTSMQQ-----EFQQKLPQELQIALEEVRARGTSFSELTTI 393

  Fly   300 VMLMSSYGFIFLAEYLTRRRD---ISLPILRKT-INSFATWTPAVALVILSYVSDQNVVGSMFCL 360
            :..::.....::|...|.|..   |...||.:| .....:|     ||.|        .|||:.|
  Fly   394 IETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSW-----LVFL--------CGSMYML 445

  Fly   361 IAATAAISGQAIGSSLN-----------HVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTK 414
               ...:||..|.|.|.           .:|:|||:||.|.|:|..:.:...::.|.:..|    
  Fly   446 ---QIKMSGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMPYLEQL---- 503

  Fly   415 ESD--------RSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWNDSPSKETE 459
            |:|        .:.|   .:|.|.|            ...||::| .|.:|.:
  Fly   504 ETDYKLVSSVRAAMW---VIGASYI------------SGDVQAFN-QPEREPQ 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 101/424 (24%)
2A0114euk 23..458 CDD:129972 105/440 (24%)
CG18788NP_652665.3 MFS 129..>280 CDD:119392 42/140 (30%)
MFS_1 135..498 CDD:284993 93/379 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.