DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and SLC17A6

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_065079.1 Gene:SLC17A6 / 57084 HGNCID:16703 Length:582 Species:Homo sapiens


Alignment Length:446 Identity:135/446 - (30%)
Similarity:225/446 - (50%) Gaps:39/446 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RFNMSVAIVAFTNANS-----------SNPNYPEYRLTEPQKSYTI-SSPFWGSCCTQMMSGYLS 88
            |.|:.||||...|.::           :..|:      :|:....| .|.|||...||:..||::
Human    88 RCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW------DPETVGMIHGSFFWGYIITQIPGGYIA 146

  Fly    89 SRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKWCPKKE 153
            ||..|..:....:|||:.|::..|.| |...:..:.:||.:|||..|..:|..:...:||.|..|
Human   147 SRLAANRVFGAAILLTSTLNMLIPSA-ARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLE 210

  Fly   154 ANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFLRYGANSPSESKFI 218
            .:|:......|...|.::...|:|:| ....||.|.|||.|..|:||.:.:|.....||::...|
Human   211 RSRLATTSFCGSYAGAVIAMPLAGIL-VQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTI 274

  Fly   219 SLAERKHIQFALEQNQVIRGATP--PVPWLQILTSRP---FIVLAFCKMSQACSFYTLMQQIPRY 278
            :..||::|:.::.::..:.||..  ..||.:..||.|   .||..||:   :.:||.|:...|.|
Human   275 TDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCR---SWTFYLLLISQPAY 336

  Fly   279 IHGIFHYSIAANALLSALPFVVM--LMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVA 341
            ...:|.:.|:...:|||:|.:||  ::...|.|  |::|..::.:|...:||.:|.......|..
Human   337 FEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQI--ADFLRSKQILSTTTVRKIMNCGGFGMEATL 399

  Fly   342 LVILSYVSDQNVVGSMFCLIAATAAISGQAI-GSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISP 405
            |:::.|...:.|..|...|   ....||.|| |.::||:|::|.:|.:|.|:||.:.:.:|::.|
Human   400 LLVVGYSHTRGVAISFLVL---AVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCP 461

  Fly   406 IVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWNDSPSKETETE 461
            |::| .:||...|.:|:.|||..:::.:.|.:.|.||.....|.|.|  .:||..|
Human   462 IIVG-AMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWAD--PEETSEE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 127/425 (30%)
2A0114euk 23..458 CDD:129972 132/441 (30%)
SLC17A6NP_065079.1 MFS_SLC17A6_7_8_VGluT 74..498 CDD:340940 128/426 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.