DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and SLC17A7

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_064705.1 Gene:SLC17A7 / 57030 HGNCID:16704 Length:560 Species:Homo sapiens


Alignment Length:476 Identity:147/476 - (30%)
Similarity:230/476 - (48%) Gaps:54/476 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RFNMSVAIVAFTNANSSNPNYPEYRLTEPQKSY---TI----SSPFWGSCCTQMMSGYLSSRFGA 93
            |.|:.||||:..| ||:........:.:.|.|:   |:    .|.|||...||:..|::..:|.|
Human    80 RCNLGVAIVSMVN-NSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAA 143

  Fly    94 KVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKWCPKKEANRMG 158
            ..:....::.|:.|::..|.| |...:..:.:||.:|||..|..:|..:...:||.|..|.:|:.
Human   144 NRVFGFAIVATSTLNMLIPSA-ARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLA 207

  Fly   159 GIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFLRYGANSPSESKFISLAER 223
            .....|...|.::...|:||| ....||.|.|||.|..||.|.|.:|.....||:....||..||
Human   208 TTAFCGSYAGAVVAMPLAGVL-VQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEER 271

  Fly   224 KHIQFALEQ-----NQVIRGATPPVPWLQILTSRP---FIVLAFCKMSQACSFYTLMQQIPRYIH 280
            |:|:.|:.:     |.:.:.:|   ||.:..||.|   .||..||:   :.:||.|:...|.|..
Human   272 KYIEDAIGESAKLMNPLTKFST---PWRRFFTSMPVYAIIVANFCR---SWTFYLLLISQPAYFE 330

  Fly   281 GIFHYSIAANALLSALPFVVM--LMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVALV 343
            .:|.:.|:...|:||||.:||  ::...|.|  |::|..||.:|...:||.:|.......|..|:
Human   331 EVFGFEISKVGLVSALPHLVMTIIVPIGGQI--ADFLRSRRIMSTTNVRKLMNCGGFGMEATLLL 393

  Fly   344 ILSYVSDQNVVGSMFCLIAATAAISGQAI-GSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIV 407
            ::.|...:.|..|...|   ....||.|| |.::||:|::|.:|.:|.|:||.:.:.:|::.||:
Human   394 VVGYSHSKGVAISFLVL---AVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPII 455

  Fly   408 IGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWND-------------------S 453
            :| .:||...|.:|:.|||..|::.:.|.:.|.:|.....|.|.:                   |
Human   456 VG-AMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGS 519

  Fly   454 PSKETETEASP--KPQASAPS 472
            ...|.|.||.|  .|.|..||
Human   520 DDSEMEDEAEPPGAPPAPPPS 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 134/423 (32%)
2A0114euk 23..458 CDD:129972 138/458 (30%)
SLC17A7NP_064705.1 MFS_SLC17A6_7_8_VGluT 66..490 CDD:340940 134/424 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..560 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148578
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.