DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and slc37a4b

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001315024.1 Gene:slc37a4b / 393914 ZFINID:ZDB-GENE-040426-827 Length:453 Species:Danio rerio


Alignment Length:440 Identity:89/440 - (20%)
Similarity:157/440 - (35%) Gaps:131/440 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EYRLTEPQKSYTISSPFWGSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATP-------FAL 115
            |..|.:.:.....||.......::.:||.||.|..|:.|....:.:...::||..       |.:
Zfish    41 EIELDKEELGLITSSQTLAYAISKFISGVLSDRISARWLFSIGLFIVGTINIAFSCSSTVMLFTV 105

  Fly   116 AWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKW--------------CPKKEANRMGGIMTTGL- 165
            .|          ||.|...|..||.....|.||              |....|..:|.|:||.| 
Zfish   106 LW----------FVNGFGQGFGWPPCGKVLRKWFEPSQFGTWWAILCCSMNLAGSLGPIITTVLV 160

  Fly   166 ---DCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFLRYGANSPSESKFISLAERKHIQ 227
               |...||  ::||::..:             :.:| ||..::   |.||:....|      ||
Zfish   161 QYYDWRVIM--SVSGLICMA-------------VAVV-CLLMVK---NEPSDVGLPS------IQ 200

  Fly   228 FALEQNQVIRGATPP---------VPWLQILTSRPFIVLAFCKMSQACSFY---TLMQQIPRYIH 280
            ...::.:..:|....         .|:|.:|::...:|..   :..||:.:   .|||:..:   
Zfish   201 PGAKKGKGKKGGPNDESSLKDFLLSPYLWVLSAGYLVVFG---VKIACTDWGQLFLMQEKGQ--- 259

  Fly   281 GIFHYSIAANALLSALPFVVMLMSSYGFIFLAEYLTRRRD--------------------ISLPI 325
                .::..::.:|||. |.....|.|..:|::....|:.                    :|:.:
Zfish   260 ----SAMMGSSYMSALE-VGGFFGSIGAGYLSDRAVARQGLGVYGNPRHGLLLMMMAGMAVSMYL 319

  Fly   326 LRKTI-----NSFATWTPAVALV-ILSYVSDQN----VVGSMFCL-----IAATAAISGQAIGSS 375
            .|.||     .....|..|:..| :|:.||::.    ::|:.|..     ||....|:.::..| 
Zfish   320 FRVTITPETPEEAPLWVLALHPVSVLTGVSEKELWILILGAAFGFSSYGPIALFGVIASESAPS- 383

  Fly   376 LNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESDRSQWRTVF 425
                    ||.    |.|:.:::....:...:.||..:..:.|..|.|.|
Zfish   384 --------NFC----GTSHAIVALMANVGAFIAGLPFSTIAKRYSWDTAF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 89/440 (20%)
2A0114euk 23..458 CDD:129972 89/440 (20%)
slc37a4bNP_001315024.1 UhpC 18..421 CDD:332119 88/438 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.