DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and CG12490

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster


Alignment Length:466 Identity:177/466 - (37%)
Similarity:276/466 - (59%) Gaps:6/466 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KGPMWGVRHLQVLFLFLCATLIVAQRFNMSVAIVAFTNANSSNPNYPEYRLTEPQKSYTISSPFW 75
            |||:.|:||:|.|.:||..|.:...|.|:.|::||.|||.::|||:|||..||.:|||..||.||
  Fly     7 KGPVLGMRHVQALLIFLNITTVFIGRLNVGVSVVAMTNAETTNPNFPEYDWTEAEKSYIFSSFFW 71

  Fly    76 GSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPC 140
            |...||.:.|||..|||.|.::...:.::.:.|..||..:.:||||....:|.|.|||.|.::||
  Fly    72 GYILTQFIGGYLCKRFGVKSVMFWGVFVSGVCSALTPLFIGFGGWQAYCGIRVVMGLAQGLVFPC 136

  Fly   141 LYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFL 205
            ::.|||||.|..|.||:|.:..||::||.:....|||:::.|.:|||...||...|...||..:.
  Fly   137 IHHHLAKWSPPAERNRLGALSHTGMECGNVSAMFLSGMIAKSAIGWPGISYVSAGLAFAWCAIWF 201

  Fly   206 RYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPWLQILTSRPFIVLAFCKMSQACSFYT 270
            .:.|::..||::|:..|..:|:.:|:.|:.......||||:.|.||.||:.|...:........|
  Fly   202 VFAADNAVESRYITQEELHYIESSLKHNEDYHKTVIPVPWMAIWTSAPFLALTLTRCCATWGLST 266

  Fly   271 LMQQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYGFIFLAEYLTRRRDISLPILRKTINSFAT 335
            |..|||.|::|:....:.:||..|||||:.|.:.||.::.:|:.|.....:||..||||.||.|.
  Fly   267 LQAQIPTYMNGVLDMDMKSNAFFSALPFLAMWIMSYVYLIIADVLLAGNRLSLTALRKTFNSLAF 331

  Fly   336 WTPAVALVILSYVSDQNVVGSMFCLIAATAAI-SGQAIGSSLNHVDLSPNFAGLLFGMSNTLMSA 399
            |.|...|:.:.:: ||........|:..:..: ||..||||||.:|||||.|.:|.|:.||.::.
  Fly   332 WIPCATLIGIGFL-DQEQKNLAIALMTISVGVNSGATIGSSLNTIDLSPNHASILMGILNTAVTV 395

  Fly   400 AGVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWNDSPSKETETEASP 464
            ..:::|:::|:.|.::.:|::|:.||:..:|:.|:||.:||.||....|.|:   :::..|...|
  Fly   396 VPIVTPLIVGVIVHEDDNRAEWQIVFIIAAVLFFVGNSVYLYFGTAVSQPWD---AEDYLTVKVP 457

  Fly   465 KPQASAPSVAE 475
            : .|..|::.|
  Fly   458 E-LAKVPAIHE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 161/420 (38%)
2A0114euk 23..458 CDD:129972 165/435 (38%)
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 168/439 (38%)
MFS 54..438 CDD:119392 145/384 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442690
Domainoid 1 1.000 46 1.000 Domainoid score I8188
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428976at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.