DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and Picot

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster


Alignment Length:503 Identity:159/503 - (31%)
Similarity:238/503 - (47%) Gaps:50/503 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WGVRHLQVLFLFLCATLIVAQRFNMSVAIVAFTNANS-------------SNPNYP-------EY 59
            :..|:.....|||........|.||||||||..|..:             .:.:.|       |:
  Fly    37 FATRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEF 101

  Fly    60 RLTEPQKSYTISSPFWGSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLF 124
            ..:...:.|.:||.|:|...||:..|.|:.::|:...|...||:.::.:...|.|...||...|.
  Fly   102 AWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLC 166

  Fly   125 WVRFVQGLAMGGMWPCLYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPL--GWP 187
            .|||:|||..|.:.||.:..||||.|..|.:|||..:..|...|||:...|||:|:....  |||
  Fly   167 AVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWP 231

  Fly   188 STFYVPGYLGIVWCLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPWLQILTSR 252
            |.|||.|.:|.||.:.||.:....||....|...|:|:|..:|....|::  :||:|:..|:.|.
  Fly   232 SIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVK--SPPIPFKAIIKSL 294

  Fly   253 PFIVLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYGFIFLAEYLTR 317
            ||..:.|..|.....:.|||.::|.|:..:..:|:.:|.|||:||::.|.:.|.....:|:::..
  Fly   295 PFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMIS 359

  Fly   318 RRDISLPILRKTINSFATWTPAVALVILSYVSDQNVVGSMFCLIAATAAI--------SGQAIGS 374
            .:..|....||.|||...:.|.|||:..||..         |..|.|.||        .|...|.
  Fly   360 SKRFSHTATRKLINSIGQYGPGVALIAASYTG---------CDRALTLAILTIGVGLNGGIYSGF 415

  Fly   375 SLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESD--RSQWRTVFLGISVILFLGNL 437
            .:||:||:|.|||.|..::|...:.||:::||..|..::..|.  ..||:.||...:.:..:...
  Fly   416 KINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGT 480

  Fly   438 MYLIFGQMTVQSWND------SPSKETETEASPKPQASAPSVAEETIS 479
            .|.|||....|.|::      .|:.:|....|| .:.|..|.|...||
  Fly   481 FYNIFGSGERQYWDNPEDDEQKPALQTTVTTSP-ARLSNGSTAPAAIS 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 144/451 (32%)
2A0114euk 23..458 CDD:129972 150/472 (32%)
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 149/470 (32%)
MFS 100..485 CDD:119392 130/395 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451977
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D46132at33392
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.