DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and Slc17a4

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_795990.2 Gene:Slc17a4 / 319848 MGIID:2442850 Length:492 Species:Mus musculus


Alignment Length:472 Identity:131/472 - (27%)
Similarity:220/472 - (46%) Gaps:48/472 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRHLQVLFLFLCATLIVAQRFNMSVAIVAFT---------NANSSNP---------------NYP 57
            :||.....|.||...|..|:.|:|.||.|..         ||::..|               ..|
Mouse    32 LRHGLAFILHLCNFSIYTQQMNLSFAITAMVNTTVASSQLNASTERPPTNSQDVWNETLQESKAP 96

  Fly    58 EYRLTEPQKSYTISSPFWGSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQL 122
            .|..|...:...:||..:||....:.:||::..||||.::...:|::::|::..|.| |..|..|
Mouse    97 VYDWTPEIQGILLSSLSYGSFIAPIPTGYVAGVFGAKYVVGLGLLISSVLTLFIPLA-ADAGVAL 160

  Fly   123 LFWVRFVQGLAMGGMWPCLYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWP 187
            |..:|.:||:|...:....|:..|||.|.:|.:::..|..:|...||.: ..::|.|....||||
Mouse   161 LIVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQLITIAASGSMLGTFL-VLIAGGLICQALGWP 224

  Fly   188 STFYVPGYLGIVWCLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPWLQILTSR 252
            ..||:.|.:|...||.:.....:.|....|||..||::|..:|.|.....|.:.|:.  .::.|.
Mouse   225 YIFYIFGGIGCACCLLWFPLVYDDPQNHPFISTGERRYITCSLAQEDCSLGWSLPIK--AMVKSL 287

  Fly   253 PFIVLAFCKMSQACSFY---TLMQQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYGFI----- 309
            |...:.   :|..|.::   |:|...|.||..:...::..:.:||||||:      :|.:     
Mouse   288 PLWAIV---VSYFCEYWLLSTVMAYTPTYISSVLQANLRDSGILSALPFM------FGCVCIILG 343

  Fly   310 -FLAEYLTRRRDISLPILRKTINSFATWTPAVALVILSYVSDQNVVGSMFCLIAATAAISGQAIG 373
             .||::|..|:.:.|..:||...:......:..|:.|.:|.........|.::::..|....: |
Mouse   344 GLLADFLLSRKILRLVTIRKLFTAVGVLASSGILLPLPWVRSSRSTTMAFLVLSSVFASLCDS-G 407

  Fly   374 SSLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLM 438
            :.:|.:|::|.:||.|.|:.......||.|:|.|.|..::::|:.. ||.||...:.|..:|.|.
Mouse   408 ALINFLDIAPRYAGFLKGLLQVFSYLAGGIAPTVAGFFISQDSEFG-WRNVFFLAAAIDVVGLLF 471

  Fly   439 YLIFGQMTVQSWNDSPS 455
            ||||.:..||.|...|:
Mouse   472 YLIFSRAEVQDWAKEPT 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 123/452 (27%)
2A0114euk 23..458 CDD:129972 129/466 (28%)
Slc17a4NP_795990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
2A0114euk 27..486 CDD:129972 130/468 (28%)
MFS 98..475 CDD:119392 109/391 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.