DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and SPAC1002.16c

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_593504.1 Gene:SPAC1002.16c / 2543262 PomBaseID:SPAC1002.16c Length:499 Species:Schizosaccharomyces pombe


Alignment Length:492 Identity:109/492 - (22%)
Similarity:184/492 - (37%) Gaps:83/492 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLFLFLCATLIVAQRFNMSVAIVAFTNANSSNPNYPEYRLTEPQKSYTISSPFWGS-CCTQMMSG 85
            ::.|:|.|.|   .|.|:..|.||         ..||....:..:...|:|.|:.: ...:|.:.
pombe    63 IMILYLVAFL---DRSNIGNAKVA---------GLPEDLKLKGDQFNIIASVFYVTFILFEMPTT 115

  Fly    86 YLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKWCP 150
            .|..:...|.:|..|::..:|.:|.|.|...:||   |...|.|.|....|::|||..:|.....
pombe   116 LLMKKVQPKRMLAFIVISYSLTTIFTGFCHNFGG---LLAARLVLGFCEAGLFPCLALYLTMIYS 177

  Fly   151 KKE-ANRMGGIMTTGLDCGTIMGFALSGVLSASPL----GWPSTFYVPGYLGIVWCLTFLRYGAN 210
            :.| |.|:..:..:....|...|.....||....:    ||...|.:.|.:|.|..:.......|
pombe   178 RVELAPRIAYLFASSALSGAFGGLFAYAVLHMDGVGGFAGWRWLFIIEGLIGFVCGVAVYFIIPN 242

  Fly   211 SPSESKFISLAERKHIQFALEQNQVIRGA---TPPVPWLQI---LTSRPFIVLAFCKMSQACSFY 269
            ..:::.|:|    |..|..:.:.|:.|.|   .....|..:   .|.....:.|..:..|....|
pombe   243 DITKAWFLS----KTHQEMMRKRQLERAADLEAAHFDWKGVKSAFTDFKVYLYALSEFGQDTCLY 303

  Fly   270 TLMQQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYGFIFLAEYLTRR---RDISLPILRKTIN 331
            .....:|..|.|:.:.|::...:  .:|..::..::|   ..|.:|:.|   |.|.|.|    .|
pombe   304 GFSTFLPAIISGMGYTSLSVQYM--TIPVYILGAATY---IAASFLSDRFHHRGIILII----GN 359

  Fly   332 SFATWTPAVALVILSYVSDQNVVGSMFCLIAATAAISGQAIGSSLNHVDLSPNFA---------G 387
            .|    |.|..::|....:...|....|.:.:.    |...|:.||...||.|.|         .
pombe   360 IF----PIVGYILLLACQNNKSVLYFACYLCSV----GVYTGAGLNVTWLSANIAPHYKRATAIS 416

  Fly   388 LLFGMSNTLMSAAGVI---SPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQS 449
            |...::|:....||.|   .|..|...:|.        .:.:.||.:|.:.|:.:|.. |.:.:.
pombe   417 LQLAIANSSGILAGQIYRYPPKYIAGHLTS--------LIAIFISTVLHVVNIFFLKH-QNSKKQ 472

  Fly   450 WNDSPSKETETEASPKPQASAPSVAEETISVERFNYL 486
            .:.:.|...:....||....|           ||:|:
pombe   473 KSLASSSTIDLSEQPKDDKDA-----------RFHYI 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 101/446 (23%)
2A0114euk 23..458 CDD:129972 103/461 (22%)
SPAC1002.16cNP_593504.1 MFS 63..455 CDD:119392 98/435 (23%)
2A0114 65..435 CDD:273326 93/405 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.