DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and SLC17A8

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 / 246213 HGNCID:20151 Length:589 Species:Homo sapiens


Alignment Length:465 Identity:137/465 - (29%)
Similarity:229/465 - (49%) Gaps:41/465 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RFNMSVAIVAFTNANSS--NPNYPEYRLT----EPQKSYTI-SSPFWGSCCTQMMSGYLSSRFGA 93
            |.|:.||||...| ||:  ....||.:..    :|:....| .|.|||...||:..|::|::|.|
Human    93 RCNLGVAIVEMVN-NSTVYVDGKPEIQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAA 156

  Fly    94 KVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKWCPKKEANRMG 158
            ..:....:.||:.|::..|.| |...:..:..||.:|||..|..:|..:...:||.|..|.:|:.
Human   157 NRVFGAAIFLTSTLNMFIPSA-ARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLA 220

  Fly   159 GIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFLRYGANSPSESKFISLAER 223
            .....|...|.::...|:||| ...:||.|.||:.|..||:|.:.:|......|:....||..|:
Human   221 TTSFCGSYAGAVVAMPLAGVL-VQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEK 284

  Fly   224 KHIQFAL-EQNQVIRGATPPVPWLQILTSRP---FIVLAFCKMSQACSFYTLMQQIPRYIHGIFH 284
            .:|:.:: |...|:..:....||.:..||.|   .||..||:   :.:||.|:...|.|...:|.
Human   285 TYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCR---SWTFYLLLISQPAYFEEVFG 346

  Fly   285 YSIAANALLSALPFVVMLMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVALVILSYVS 349
            ::|:...||||:|.:||.:.......||:||..|:.::...:||.:|.......|..|:::.:..
Human   347 FAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSH 411

  Fly   350 DQNVVGSMFCLIAATAAISGQAI-GSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVT 413
            .:.|..|...|   ....||.|| |.::||:|::|.:|.:|.|:||.:.:.:|::.|:::| .:|
Human   412 TKGVAISFLVL---AVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVG-AMT 472

  Fly   414 KESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWND--SPSKET-----------------E 459
            :...|.:|:.|||..:::.:.|.:.|.:|.....|.|.|  :.|:|.                 |
Human   473 RHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHE 537

  Fly   460 TEASPKPQAS 469
            :.||||.:.|
Human   538 SFASPKKKMS 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 125/417 (30%)
2A0114euk 23..458 CDD:129972 130/435 (30%)
SLC17A8NP_647480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..61
2A0114euk 75..513 CDD:129972 129/429 (30%)
MFS 80..502 CDD:119392 125/418 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.