DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and H11E01.2

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_508300.3 Gene:H11E01.2 / 186721 WormBaseID:WBGene00019187 Length:470 Species:Caenorhabditis elegans


Alignment Length:485 Identity:101/485 - (20%)
Similarity:178/485 - (36%) Gaps:95/485 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RHLQVLFLFLCATLIVAQRFNMSVAIVAFTNANSSNPN--YP--------EYRLTEPQKSYTISS 72
            |::.:....||...|.:   ||:|  :.||....:.|:  .|        .:..:..|||..:.:
 Worm    18 RYIVLAIGTLCIASIAS---NMTV--INFTMICMAKPSELVPTTDQEGTINFSYSNEQKSVIMWA 77

  Fly    73 PFWGSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGM 137
            ...|:........:...:|||:.:.......:.:.:...|.| |...:..|...||.||::.|..
 Worm    78 AAVGTLAAAWPFHWFYEKFGARRVFFAAGAFSTISTALMPLA-AHIHFNFLVVARFFQGVSFGAD 141

  Fly   138 WPCLYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFY----VPGYLGI 198
            :..:...:..|...|:......::::......:....::|.|..|..||.|.:|    |.|.|.:
 Worm   142 FAAIGLIVVNWASLKQHGLFISLLSSFSQISVMFTMPVAGELCESKYGWESVYYGHAAVSGALFV 206

  Fly   199 VWCLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPV------PWLQILTSRPFI-- 255
            :|. .|.|   ::||          ||.|....:.:.||.....|      |..:|||: |.:  
 Worm   207 LWA-WFYR---DNPS----------KHPQMTETELEKIRRGKGEVKEHEKAPIAKILTN-PVMQS 256

  Fly   256 --VLAF--CKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALPFVVML-------MSSYGFI 309
              :.||  ..|||....|.     |.::..:..:::.......|:|..:.|       ::|....
 Worm   257 VWLSAFGELMMSQFIVMYE-----PTFLKEVLGFTVNHTGYFVAIPRALHLTFKIISGIASDRIS 316

  Fly   310 FLAEYLTRRRDISLPILRKTINSFATWTPAVALVILSYVSDQNVVGSMFCLI---AATAAISG-- 369
            |..|....|          ..|:.|.........:|.|:..::...|:..||   .:|..|.|  
 Worm   317 FWTEKSKMR----------IFNTIALMGSGTFFCVLGYIPKEHAHLSLVALIIIECSTGFICGGF 371

  Fly   370 ----QAIGSSLNHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISV 430
                ..:....:|..||.    :.|....:|.     |.|:::.|..|..: ..:||.|||...:
 Worm   372 YKCATLVARQHSHFVLSQ----IQFIKCLSLF-----IEPLLVFLICTSNT-LEEWRIVFLTHGI 426

  Fly   431 ILFLGNLMYLIFGQMTVQSWNDSPSKETET 460
            :|..||:::..|.       .|.|:..|.|
 Worm   427 LLIAGNIIFCYFA-------TDRPADFTHT 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 95/461 (21%)
2A0114euk 23..458 CDD:129972 98/476 (21%)
H11E01.2NP_508300.3 MFS 19..439 CDD:391944 95/465 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.