DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3649 and F41C3.2

DIOPT Version :9

Sequence 1:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_494849.2 Gene:F41C3.2 / 173821 WormBaseID:WBGene00018268 Length:499 Species:Caenorhabditis elegans


Alignment Length:491 Identity:109/491 - (22%)
Similarity:201/491 - (40%) Gaps:68/491 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FLCA------TLIVA--QRFNMSVAIVAFTNANSSN----------PNYPEYRLTEPQKSYTISS 72
            ::||      ||:.|  ..:|.:|..:......::|          |:...:..::.::....|:
 Worm    36 YICAIVTGLMTLVQANVHVYNFTVLCMQEEQEKANNESLSRNETILPSSLNFNFSKFEQDLLFSA 100

  Fly    73 PFWGSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFW-VRFVQGL--AM 134
            .:.....:.::..:|::|.|.|...|...:|:.|.:|.||.|..:|.|  .|| .||.|||  |:
 Worm   101 AYIAPLPSIIILYFLTNRSGVKTTFLICSMLSFLSTILTPIATQYGFW--FFWAARFFQGLPTAI 163

  Fly   135 GGMWPCLYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIV 199
            .|:...:.|  ..|....|......|:........::...|| .|..|..||.|.:|..|.:..:
 Worm   164 LGIVVSVVT--CHWSTLTENGTYVSILAAHYQIAPLLTMPLS-ALMCSVGGWSSVYYTQGTITAI 225

  Fly   200 WCLTFLRYGANSPSESKFISLAERKHIQ--FALEQNQVIRGATP-------PVPWLQILTSRPFI 255
            ..:.|..:..:.||||||:|..|.|.|:  .:||:..|.:..||       |..|...:||    
 Worm   226 LIVLFAVFYTDKPSESKFVSKGELKAIEDGKSLEEKHVEKSKTPFVAIHKDPAVWAIWITS---- 286

  Fly   256 VLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALPFVVMLMS-------SYGFIFLAE 313
                  :.....|...:|..|.|::.:.||:::.....:|:|::...::       |....||.|
 Worm   287 ------VGGTIGFSIFLQYGPTYLNKVLHYNLSTTGWTAAVPYIFSCIARIVAQPLSANCSFLGE 345

  Fly   314 YLTRRRDISLPILRKTINSFATWTPAVALVILSYVSDQ-NVVGSM-FCLIAATAAISGQAIGSSL 376
            .|.       .|:..||:.   .|.|:..::|.::... :.||.: :.|:.....::|..|..|.
 Worm   346 RLA-------AIVTTTISQ---GTMAICFLVLMFIPQTWSSVGQLCYSLVIVANGLNGVGITRSA 400

  Fly   377 NHVDLSPNFAGLLFGMSNTLMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLI 441
            ..|  .......::........:.|:..|:::.. |......::|..:||.|..|:|:.||:::.
 Worm   401 QLV--CKQHMSFVYTARAFYNGSVGLFLPLLVNF-VAPNDTHNEWTRLFLIIFCIVFVSNLIFIA 462

  Fly   442 FGQMTVQSWNDSPSK-ETETEASPKPQASAPSVAEE 476
            |.......|....|: :..:|...:.|.|..:..|:
 Worm   463 FSSTEPAQWTIGTSEVDNRSEQDLEDQKSTSTTVEK 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3649NP_611725.2 MFS 22..442 CDD:119392 102/454 (22%)
2A0114euk 23..458 CDD:129972 105/471 (22%)
F41C3.2NP_494849.2 2A0114euk 30..471 CDD:129972 103/462 (22%)
MFS 86..463 CDD:119392 93/404 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.