DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and YOL162W

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:41/195 - (21%)
Similarity:76/195 - (38%) Gaps:48/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 LALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPF---LAMWLLSYVYLIAADVLL 312
            ||..:|....:.|.:|.||.:.:..|.||::.:.....:|:...   |.:.||..:|.:      
Yeast    12 LATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLFGLTWSTEKCNNRLGLSLLQPLYTV------ 70

  Fly   313 KKKILSLTAVRK-----LFN--------TLSFWIPAAALIGIGFLSEENKNLAIVLMTVS----- 359
                 .|.||.:     :||        ||....|....|.:...|..::  ::...|||     
Yeast    71 -----PLLAVLRFWKGTMFNKWGTYAIITLILDNPYIHAICVSLCSRNSQ--SVKTRTVSTCLYN 128

  Fly   360 VGVNSGATIGSSLNSIDLSPNHA---GILIGLSNTVANVIPILTPLIAGE----IVADKHNRGQW 417
            :.|.:|..|.|::.:...:|.:.   |:|.||:       ..:.|::.|.    :..:|....:|
Yeast   129 MFVQAGLIISSNIYAKSDAPLYRKGNGVLFGLA-------LFMFPILIGSKLIYVYINKQRDKRW 186

  Fly   418  417
            Yeast   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 41/195 (21%)
MFS 19..438 CDD:119392 41/195 (21%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 38/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.